SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018783098.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018783098.1.52592
Domain Number 1 Region: 381-601
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-56
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 74-192
Classification Level Classification E-value
Superfamily BRCT domain 1.74e-18
Family DNA-repair protein XRCC1 0.043
Further Details:      
 
Domain Number 3 Region: 208-288
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000032
Family DNA topoisomerase II binding protein 1, TopBP1 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018783098.1.52592
Sequence length 862
Comment PREDICTED: protein ECT2 isoform X3 [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MDAMETIDEQSKSEMSISPSPSPENLRICLVGDVVNDTETVEAARCFNVPVITSENGLDV
LNDYAWRTFFVLKDFEGPIYDAIHRNKQCILGPPALQHAAESKDGLIRNARPVYNYSMRG
VVTCFTGIRKKDELTRLVNLIHSMGGCIRKDMNSKITHLICSHSGGDKYQYAKTFRLTVV
RPAWVYAAWERRDELQFRATTDDFSREHKLKAFEGQKICFFGFPADEHQHMVDVLLSNGG
VPAELDDPECSHVVVDEHTTQAKPEPKNHRTHILKSDWFWYTIQNGYADEMDYLFGDYLD
SIANTPNTDRRDSLPISFNKRKRKRFSQRIQFEGTPIGSGKRRSSVSDAGLLSVSGSFFD
CTTSPDKLEAGKLHNEVHIETPTVCESTPAKKSMRFNHFMDFFSTESNYVGILDTIVKLF
KNPLEEIAETNDALLNKSEIKSIFNNFLPIHEVHQCMLESLRAIQGKWSEDCLIGDIILQ
HRDELTKAYPPYVNFFEQMKETLQQCDSQNPRFHAFLKINQTKPECGRQSLQDLMIRPVQ
RLPSISLLLNDILKHTNKNNPDYVKLEQALKAIKEVMMHINEDKRKTESRMAIFDIFNDI
EGCPAHLVSSNRSFISKCEVTELSDNLSGRGDTLMLYLFSDTIEVCKKRSRAFNTAKSPS
STKSYKHVKLVSLNAIRFVIDITDSPRAFALLCRQDKEKLFSFTITDDETDKVVYLKLLC
KQMAENACRTDTVSALLSRTSQELEVDISDVNLSTLSKAFKLAARTRQKVGRAFSFNKTP
SKLKRAVSTMMTPPFGSTNSLTPASQLAQMRLASCANIHEAVDEEGNRSSSPSVQSEILL
PPLSVQPMRKNKSSTLGVVGRL
Download sequence
Identical sequences XP_018783098.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]