SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018794464.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018794464.1.52592
Domain Number 1 Region: 726-870
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-35
Family Toll/Interleukin receptor TIR domain 0.0002
Further Details:      
 
Domain Number 2 Region: 146-362,396-474
Classification Level Classification E-value
Superfamily L domain-like 8.33e-25
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 3 Region: 543-659
Classification Level Classification E-value
Superfamily L domain-like 6.8e-17
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018794464.1.52592
Sequence length 901
Comment PREDICTED: protein toll-like [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MLNDEKKMWHNCIRLITLYALATPSGLAGAKLELPTQPQICNSEMCECTSANFECRLKGR
FSLVNVESRVRVWNAQTDVLTAYDLNITCIYEPEDLNVVLNMMPPIIFEEPLQYYLKNCL
EYPAILQQSHVTYEGIVEFDQYLETPPRFFNQTPVLQALTLPVHFNYVKNPLPPQLLHNL
TNLQHLVLQLYTPYPEVRYPVELLHTLYKLETLSIELIALQTNVRDTQSAHFRDLRALKQ
LNLEANHMTALPAKLFSTLPELRRLSLRLNDLEELPPDLLRMQRKLLVLDISENHLSALP
KGLFDNTPLLWELLLAHNRFSVPTSIIENVHALNFLRKINLGYNGLQTVWGTGIYSNHTL
FTRANITDAQSLTNFERMVKYIAVLRELEPLNYTEVVLRANQLTYFSLDWIAAAGISCPY
YIDLAINNISHVHALLSPTKATCRQEVHLLYNPLVCDCELAWIYNTNMLVIGVQWQCATP
ERLYGSDLRNLHRDALCDWSPAWCPLKCRCTRQLNALLIDCSAAALQALSQLPRPEQLSL
VETTLNLTRNQFRELPSNATFGYANVTRLYAAHNRLNTLLPTHLPHTLRVLDLRTNQLQR
LGENFLRAYLNDSATLTALYLSDNPWLCDCATELFLYTLRVHHSRIPDIEELFCANLPNI
TLANVTFTDICVTPTNSWALITQLIAAFLTILTLLTCIALYYKYELELKVWLHAHNVNIA
CCSIDEMDCNKTFDAFISYAHEQSDYVNQVLVPGLEKTAPYFRICTHERNWLAGAYIPEQ
IVESVAQSRRTIIVLSQDFVASLWARMEFKTAHQFAVNERRARIIIIKYGEVGDMAGLDS
ELQAYLRMNTYLESEDPRFWQKLRYAMPHLRGEGRKAGMLEVGERVYVRGQVELNQMAIS
K
Download sequence
Identical sequences XP_018794464.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]