SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018797190.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018797190.1.52592
Domain Number 1 Region: 637-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 183-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000457
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 377-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000003
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 690-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000928
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 494-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000334
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 6 Region: 609-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000034
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 555-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000756
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018797190.1.52592
Sequence length 1301
Comment PREDICTED: uncharacterized protein LOC108974050 [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MDRQTFEIQWIQDQDDLKAASEQLIVKPQMPSEDELLSNDATGAGRGSYHLVTGNDEDGD
VTNEVDIDQIAAENLIFMARDGQMVTEIIDASAADNGKVVVATSDEIDCSQVLQQTGNGF
IDGFVDTTPQMVTEEVITDDWVQHQGEERVEIPADQIICSGSQVLLDMEVPLPTVQDEYT
ALRPYPCDFCSRRFRKKTSLMNHIVAHQNDRPHLCKLCGSRFFRRSDLINHLKAHADAPD
PELDTEFMNFVEQEQQQLQLRQPNDHFYEQDWTTHINSLQRTEKSSRKPHNVSGNSSSTS
TSTTTGRGRISRLKPKEESYVLNEPHENETVGLANLENRSSAFEDCQQLQASTAVVKFSQ
NQSPTHQKSFPVIDESKPFVCQQCGLAFAREKAMLAHTKNHNEDHPHECNQCNEMFWDAG
SLQEHLKTHQFEDSNSEYDPDEAEAEETQSESESERLYGEFYCSECGMSFHREDLLRRHS
KLHIKTIAECDIDKDRHCCNTCGETFAEALDLLAHAEIHARYPPYKCVLCGETFFEELAI
KRHLQSVHPHDMTPNSCILCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKR
HMASHRDKSVICDVCQEEFPDGRTLSNHRHSHTNASGKLFPCHECGKTFGSRSSQQIHVR
IHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYACSVCSRAFNQRVVLREHIRSHHS
GLDAKRNTYYCTVCSMEMSSSGDLVQHLIQHSDMNTAMQRQPITGPRKYKRRRKLKPHEI
ARLRRESQQNGNGSDIELSDFDMDNVDDLLGITEPIPVSKASKSKRNKVKDSINNNSLMK
EGVDGVILPDNDLLMQSRKPRYKSTGSNSDTLWQTKLINSNTLLSNLENTLQSIDTLVVG
SSVGGATHLDPEERKPKYKSGSEISSGGGSQRTQEVQINKNYNANKTRKRTEKASTSKAT
RPRMIHTEKLSSTYNEYGRKRSKTVITHREQNGLDLLRPTGRSMVDDYEILSPATELPRQ
ISSSPPRIKQEIGQNNHEESSHQLRGLQYDAHVANSSRNVDLYDTQFLDAASTLRKEAYE
KFNPSIVNDLEEILRSPIKCDRAERHRFISESSTPFLEDEQHNMIKIEPTSPDLHEIVVG
VSGSAGVSASGGSGSSNERHYARSARNRTGTMNRKYLEFESDLQTNGSTRHQKRSSTNIN
GSSSKSKQSKSNRREKKESSVINQRTTAYSSTYGGSLTTTNDSSFSSLSPTDGVTAASAV
TATSSPAPTQPERKVRYFECEMCSAVFPDRAQLLDHVPIHI
Download sequence
Identical sequences A0A0K8U7U6
XP_018797190.1.52592 XP_018797191.1.52592 XP_018797193.1.52592 XP_018797194.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]