SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018799948.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018799948.1.52592
Domain Number 1 Region: 132-579
Classification Level Classification E-value
Superfamily Sema domain 1.03e-127
Family Sema domain 0.0000492
Further Details:      
 
Domain Number 2 Region: 1450-1578,1787-1948
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.67e-42
Family p120GAP domain-like 0.049
Further Details:      
 
Domain Number 3 Region: 940-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000000344
Family Other IPT/TIG domains 0.0081
Further Details:      
 
Domain Number 4 Region: 582-633
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000432
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 1034-1122
Classification Level Classification E-value
Superfamily E set domains 0.0000000000713
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 6 Region: 1141-1223
Classification Level Classification E-value
Superfamily E set domains 0.000000322
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018799948.1.52592
Sequence length 2005
Comment PREDICTED: plexin-A2 [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MRAIIWFLLAFMLHYVTSIRSINTQNSQIKSSSRINDNNHIGTDILYASSLLNAVHIHNT
ELLSDDQELVQNNDGIIDGFTSASLKSALSDSNGGSSPSLSASAQFGDGEDSGKGGAVDA
KNYSNIITNNINFDTPLNHLVVDTFTGRVFVGGVNYLYQLSPELELHETVKTGPKNDSVE
CTVLDCPAHAVRKPTDNYNKVLLIDRATSRLIACGSLFQGTCSVRNLQNISIVEQDVPDA
VVANDANSSTVAFIAPGPPQPSITNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIA
SSAVTTGTRTFINSYAREGYLINYVYGFSSERFSYFLTTQLKHNYHSSPKEYITKVVRIC
QEDSNYYSYTEIPIDCITGGTKYNLVQAGYLGKPSMDLAGSLGITVQDDVLFGVFSVGDG
NVSTDNSALCIYSLKSIRRKFMQNIKSCFNGVGSRGLDFISPNMLCVPTKLQTIGEDFCG
LDVNSPLGGEQPIAVVPVAKFDTRLTAVAATSTSGYTVVFIGTANGHLKKVVVESVDSAN
EYADIPIKVGSPINPDMHFDSRNLFIYVMSLNEVAKVKVYDCSDYRTCGECLGARDPYCG
WCSLENKCSPRSSCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLPQ
LKENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTKDGPD
LVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSY
RSGPGFCPTINATGEGSEMLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNA
QLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMADSCGMC
LALSEKYNCGWCSSTNTCEVEEQCNKNNEGKTDWLNRMETCPNPEIHLFYPKTGPWEGGT
NITIRGINLGKNFSDIYSGVRIAGISCMPFPEYYVDTKEIVCNVDSPGVQLYRSGRIVVQ
IGDYRGESKEDYEFVDPKITHFSPQYGPVSGGTHLRIVGKYLNAGSRIQAFINEHLRCEI
ISVDVTEAICRTAPSPGIIEGRLKMLFDNGPREFNEYNFKYVLDPTIDQVSSGPSSQLKV
PRGIPAGGIEIAVTGTQFNYIQSPRMYVYYKSQIFYSQCKVQSGTDMLCYSPVIETGNDI
FDADNPELLEYGFIMDNVLRVQNLSSKQNNHFELYPNPLYYNFEEDIKYYKSEYLTINGR
NLDRACKETDVVVRIGKGICNITSLSRQQLTCRPPPEVATESNNESGPEVVVRIGHSLQY
RIGILSYASPNLMHDLSKNVQLGIGAGTVVILLIFVAFLVAYKKKTSESNRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRLFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQLIDFRPMTVFASIIQQPIFCNSIDMMPT
HTENVPVKVLDCDTIGQVKEKCLDTIYRNIPWSQRPRRDDLDLEWRTGASGRVILYDEDT
TSKTESEWKKLNALQHYNVPDGAGLSLVPKQSSNYNFSILSDRNEKCHKYETLNLSKYTS
SSPTFSRAGSPLNNDLHENGIKFWHLVKHHDSDIQKEGERVNKLVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALLHGITDHEVVHTWKSNSLPLRFW
VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
KWVERYYRDIREMPSISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
EEDEFSQKQRLAFKLEQVHNMMSGE
Download sequence
Identical sequences A0A0K8VP38
XP_018799948.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]