SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018865203.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018865203.1.27298
Domain Number 1 Region: 135-382
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.62e-41
Family Actin/HSP70 0.00037
Further Details:      
 
Domain Number 2 Region: 12-139
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.69e-27
Family Actin/HSP70 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018865203.1.27298
Sequence length 417
Comment PREDICTED: actin-related protein 10 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERP
SPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLA
ENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
Download sequence
Identical sequences G3QVF4 Q9NZ32
gi|8923712|ref|NP_060947.1| NP_060947.1.87134 NP_060947.1.92137 XP_018865203.1.27298 ENSP00000254286 NYSGRC-8923712 ENSP00000254286 ENSP00000254286 9606.ENSP00000254286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]