SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018869625.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018869625.1.27298
Domain Number 1 Region: 8-250
Classification Level Classification E-value
Superfamily HAD-like 1.07e-55
Family NagD-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018869625.1.27298
Sequence length 259
Comment PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 2 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAARRALKAVLVDLSGTLHTEDAAVPGAQEALKRLRGASVIVRFVTNTTKESKQDLLERL
RKLEFDISEDEIFTSLTAARSLLEQKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPE
HFHYQNLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP
EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPP
YLTCESFPHAVDHILQHLL
Download sequence
Identical sequences G3RJW4
ENSGGOP00000016014 ENSGGOP00000016014 XP_018869625.1.27298 XP_018869626.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]