SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018874732.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018874732.1.27298
Domain Number 1 Region: 93-518
Classification Level Classification E-value
Superfamily Sema domain 1.44e-100
Family Sema domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1323-1449,1644-1795
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.61e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 879-974
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000747
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 971-1013,1048-1101
Classification Level Classification E-value
Superfamily E set domains 0.000000000000723
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number 5 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000115
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1115-1196
Classification Level Classification E-value
Superfamily E set domains 0.0000436
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018874732.1.27298
Sequence length 1863
Comment PREDICTED: plexin-B3 isoform X6 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSSSLCAPSVSLSPLTLSHSPSLCLPPSLALSTLASVHPTFHLPLVLYLPCAPTALTCAL
SQAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALAPGRGTLYVGAVNR
LFQLSPELQLEAVAVTGPVIDSPDCVPFRDPTECPQAQLTDNANQLLLVSSRAQELVACG
QVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPLPGRDLLLVARGLA
GKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFADARSAYFVFRRRGA
RAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLLGAFAAGPRGTQAA
LCAFPMAELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTLPLDSPESYPCGDE
HTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQLHKVFLHGSQGQVY
HSQQVGLPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDCASCLQAQDPLCGW
CVLQGRCTRKGQCGRAGQLNQWLWSYEEDRHCLHIQSLLPGHHPRQEQGQVTLSVPRLPI
LDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTVPLALMFEDVAVAA
TNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPEGERTIYSAQEVDV
QVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHCWLELPGELRGLPA
TLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHALYVILYDCAMGHP
DCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAVEPLTGPPEGGLAL
TILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPNGTTGPVRVAIKSQ
PPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSAFVGGQPCPMAQPQ
DPQPRRRCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRARPQRVFFTL
DNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEV
RVHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPP
LSAFPMEAQAGVGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCR
KEFTDLMTEMTDLSSDLEASGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATV
RQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTL
LGDLAAHYVHRNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVD
KGPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSETQRVPARVLDTD
TITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNT
LQHYKVPDGATVGLVPQLHSGSTISQSLAQRCPLGENIPTLEDGEEGGLCLWHLVKATEE
PEGAKVRCSSLREREPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVK
YLFDLLDELAEKHGIEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVI
AQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALA
ELSGNYTSAPHCLEALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKV
TDL
Download sequence
Identical sequences XP_018874732.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]