SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018876836.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018876836.1.27298
Domain Number 1 Region: 153-339,429-530
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.64e-44
Family AstE/AspA-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018876836.1.27298
Sequence length 886
Comment PREDICTED: cytosolic carboxypeptidase-like protein 5 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRP
DCAETEFENGNRSWFYFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWE
RIRDRPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHP
THSSPLDTIYYHRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPRPFRFA
GKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRG
HYRTDSRGVNLNRQYLKPDAILHPAIYGAKAVLLYHHVHSRLNSQSSSEHQPSPCLPPDA
PVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEEPAPDTI
PPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFS
EKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASP
PPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNS
RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGGSSSSQQNSPQ
MKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRSQDRRRRQQPLNHRPAGSLAP
SPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGLLGTGARMPCI
KTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSCSATPGLPQARPPRPR
SAPAFSPISCSLSDSPSWNCYSGGPLGQPEVCFVPKSPPLTVSPRV
Download sequence
Identical sequences G3RL84
ENSGGOP00000016523 XP_004029020.1.27298 XP_018876836.1.27298 ENSGGOP00000016523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]