SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018877036.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018877036.1.27298
Domain Number 1 Region: 75-252
Classification Level Classification E-value
Superfamily EF-hand 1.24e-48
Family Calmodulin-like 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018877036.1.27298
Sequence length 256
Comment PREDICTED: calsenilin isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGVKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLETCQ
KDENIMSSMQLFENVI
Download sequence
Identical sequences G3R304
XP_018877036.1.27298 ENSGGOP00000009619 ENSGGOP00000009619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]