SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018877100.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018877100.1.27298
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily AMPKBI-like 5.86e-36
Family AMPKBI-like 0.00000434
Further Details:      
 
Domain Number 2 Region: 76-156
Classification Level Classification E-value
Superfamily E set domains 5.28e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018877100.1.27298
Sequence length 272
Comment PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences G3SCS5 O43741
gi|4885561|ref|NP_005390.1| 6b2e_B ENSP00000254101 ENSP00000254101 ENSP00000463518 ENSGGOP00000025903 ENSGGOP00000025903 NP_005390.1.87134 NP_005390.1.92137 XP_004026557.1.27298 XP_018877100.1.27298 XP_018877104.1.27298 9606.ENSP00000254101 ENSP00000254101 ENSP00000463518 GO.33898 HR13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]