SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018880448.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018880448.1.27298
Domain Number 1 Region: 630-778
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-47
Family Toll/Interleukin receptor TIR domain 0.0000000388
Further Details:      
 
Domain Number 2 Region: 30-164,353-540
Classification Level Classification E-value
Superfamily L domain-like 3.57e-40
Family Leucine rich effector protein YopM 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018880448.1.27298
Sequence length 786
Comment PREDICTED: toll-like receptor 1 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIRVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFRFNQELEYLDLSHNKLAKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSSLTLNNIETTWNSFFRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFSFPQSDIYEIFSNMNIKNFTVSGTPMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKVRSIKAGDNPFQCTCELREFVKNID
QASSEVVEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIITIGATMLVLAVTVTSL
CIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNNLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK
Download sequence
Identical sequences S5PZP2
XP_018880447.1.27298 XP_018880448.1.27298 ENSGGOP00000012870 ENSGGOP00000012870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]