SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018880526.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018880526.1.27298
Domain Number 1 Region: 238-347
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00041
Further Details:      
 
Domain Number 2 Region: 137-241
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 
Domain Number 3 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018880526.1.27298
Sequence length 347
Comment PREDICTED: CD5 antigen-like [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MALLFSLILAIYTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
VCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLG
CGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
PFDLRLVGGDNLCCGRLEVLHKGVWGSVCDDDWGEKEDQVVCKQLGCGKSLSPSFRNRKS
YGPGVGRIWLDNVRCSGEEQSLEQCKHRFWGFHDCTHQEDVAVFCSG
Download sequence
Identical sequences G3R058
ENSGGOP00000008535 ENSGGOP00000008535 XP_018880526.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]