SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018881642.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018881642.1.27298
Domain Number 1 Region: 280-376
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 26-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000222
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 3 Region: 439-730
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000392
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000131
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 5 Region: 89-191
Classification Level Classification E-value
Superfamily EF-hand 0.0000000014
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018881642.1.27298
Sequence length 792
Comment PREDICTED: follistatin-related protein 5 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MIQDGPFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVH
RAACLKKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISR
KKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLAL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLE
DINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRH
IKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHRIHTQPVGKQF
DRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAHT
HLGGYYFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGL
VRVQYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLLVELSSGK
VKMIKSLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEV
EKGNTVIWVGDA
Download sequence
Identical sequences XP_018881642.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]