SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018882803.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018882803.1.27298
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-32
Family cAMP-binding domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 7.32e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018882803.1.27298
Sequence length 381
Comment PREDICTED: cAMP-dependent protein kinase type I-alpha regulatory subunit [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTAQPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences G3RK51
ENSGGOP00000016110 XP_004041145.1.27298 XP_004041146.1.27298 XP_004041147.1.27298 XP_018882802.1.27298 XP_018882803.1.27298 ENSGGOP00000016110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]