SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018883638.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018883638.1.27298
Domain Number 1 Region: 157-260,302-573
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.24e-146
Family Myotubularin-like phosphatases 0.0000000612
Further Details:      
 
Domain Number 2 Region: 1110-1176
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.04e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 50-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000271
Family GRAM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018883638.1.27298
Sequence length 1195
Comment PREDICTED: myotubularin-related protein 4 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETSFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKNHKSCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPDPSAQDELGRTLDGIGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQNSPTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPLSAACQTPLDPSADFLNQDPSGS
VASISHQEQLSSVLDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGVK
SPVCSSHSNGHCTGPGGKNQMWLSGHPKQVSSTKPVPLTCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQLRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
Download sequence
Identical sequences G3RD67
XP_004041326.1.27298 XP_018883638.1.27298 ENSGGOP00000013464 ENSGGOP00000013464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]