SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018883999.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018883999.1.27298
Domain Number 1 Region: 168-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000599
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000407
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  XP_018883999.1.27298
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0357
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018883999.1.27298
Sequence length 406
Comment PREDICTED: LIM/homeobox protein Lhx1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Download sequence
Identical sequences A0A096P515 A0A0D9R170 A0A2I2V4T1 A0A2J8LJQ5 A0A2K5EFT2 A0A2K5MHK7 A0A2K5S4G4 A0A2K5TVG1 A0A2K5YD72 A0A2K6CQU0 A0A2K6JRI5 A0A2K6NW71 E2RMA8 F2Z531 G3QJR1 G7NI09 H0VUK6 H2NTG1 L9KFS0 M3YUD9 Q5IS44 Q5IS89
ENSMPUP00000014949 ENSCAFP00000026343 ENSPANP00000020440 ENSDNOP00000024310 NP_001029088.1.37143 NP_001266932.1.74449 XP_002827352.1.23681 XP_003131754.1.46622 XP_003469634.1.53824 XP_003818003.1.60992 XP_003996636.1.62641 XP_004397754.1.74151 XP_004434885.1.5094 XP_004476440.1.11602 XP_004591006.1.84141 XP_004608654.1.94378 XP_004643065.1.9945 XP_004684516.1.23501 XP_004747246.1.14098 XP_005583979.1.63531 XP_006154506.1.99106 XP_006732751.1.47382 XP_006832409.1.41390 XP_006881446.1.29581 XP_008009363.1.81039 XP_008568024.1.73410 XP_010375176.1.97406 XP_011731472.1.29376 XP_011845613.1.47321 XP_011910473.1.92194 XP_012300999.1.9421 XP_013972209.1.84170 XP_014717756.1.49734 XP_014974945.1.72884 XP_015293887.1.63531 XP_015293888.1.63531 XP_017395343.1.71028 XP_017722480.1.44346 XP_018883999.1.27298 XP_019279584.1.44245 XP_020026692.1.5219 XP_021560128.1.83697 ENSPPYP00000009230 ENSPPYP00000009230 ENSSSCP00000018746 ENSGGOP00000002664 10141.ENSCPOP00000014380 9600.ENSPPYP00000009230 9615.ENSCAFP00000026343 9823.ENSSSCP00000018746 ENSCAFP00000026343 ENSCPOP00000014380 ENSCPOP00000014380 ENSSSCP00000018746 ENSFCAP00000004712 ENSMPUP00000014949 ENSGGOP00000002664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]