SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018884288.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018884288.1.27298
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-25
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 8.44e-21
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-19
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  XP_018884288.1.27298
Domain Number - Region: 384-425
Classification Level Classification E-value
Superfamily ARM repeat 0.00104
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018884288.1.27298
Sequence length 539
Comment PREDICTED: tripartite motif-containing protein 26 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRICTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSMKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences G3SBR4
ENSGGOP00000008179 XP_018884286.1.27298 XP_018884287.1.27298 XP_018884288.1.27298 XP_018884289.1.27298 XP_018884290.1.27298 ENSGGOP00000025541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]