SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018884341.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018884341.1.27298
Domain Number 1 Region: 193-456
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.32e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018884341.1.27298
Sequence length 465
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 7 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MVGKAWPLTHSQAMGPWAPEGHRREAADPWWQRQQAQEGRMQLGCAWVAARRGGGRKLAS
WSLLSPQRQNDRQTDSWQEAAWGPQLLQQTSWLSEPPLGPAPHPSMVQAHGGRSRAQPLT
LSLEAAMTQPPPAKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFL
RTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSR
VCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLT
QLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEECRSVKHILFSAW
PDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARG
EVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Download sequence
Identical sequences G3RK58
XP_004028207.1.27298 XP_018884341.1.27298 ENSGGOP00000016118 ENSGGOP00000016118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]