SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018886749.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018886749.1.27298
Domain Number 1 Region: 234-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 520-635
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-16
Family Second domain of FERM 0.0018
Further Details:      
 
Weak hits

Sequence:  XP_018886749.1.27298
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0672
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018886749.1.27298
Sequence length 736
Comment PREDICTED: krev interaction trapped protein 1 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLEMKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNICEENKQNNWEESAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences G3QHP7
XP_018886742.1.27298 XP_018886743.1.27298 XP_018886744.1.27298 XP_018886745.1.27298 XP_018886747.1.27298 XP_018886748.1.27298 XP_018886749.1.27298 XP_018886750.1.27298 XP_018886751.1.27298 XP_018886752.1.27298 ENSGGOP00000001880 ENSGGOP00000001880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]