SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018887122.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018887122.1.27298
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-47
Family SPRY domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-21
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.05e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018887122.1.27298
Sequence length 477
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM17 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECREMSPQRNLLPNRLLTKVAEMARQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLVEEEQRLLQALETEEDETASRLRESMACLDRQGHSLELLLLQLE
ERSTQAPLQMLQDMKEPLSRKSNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
ATSAYPYLLLYESRQRRYLGCSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGLNIT
GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSAFSALTPVMLMEPPSHMGI
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences XP_018887113.1.27298 XP_018887122.1.27298 ENSGGOP00000016490 ENSGGOP00000016490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]