SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018889088.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018889088.1.27298
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000562
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-35
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.45e-21
Family First domain of FERM 0.0025
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-20
Family PDZ domain 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018889088.1.27298
Sequence length 913
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 3 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKITKQDTGQVLLDMVYN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPEVMDHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDREPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences G3RTL6
XP_004048470.2.27298 XP_018889088.1.27298 ENSGGOP00000019142 ENSGGOP00000019142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]