SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018889482.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018889482.1.27298
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.91e-25
Family Ubiquitin-related 0.00000663
Further Details:      
 
Domain Number 2 Region: 272-339
Classification Level Classification E-value
Superfamily XPC-binding domain 3.4e-24
Family XPC-binding domain 0.0000183
Further Details:      
 
Domain Number 3 Region: 174-230
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000559
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 356-407
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000172
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018889482.1.27298
Sequence length 409
Comment PREDICTED: UV excision repair protein RAD23 homolog B isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences G3QJ86 P54727
ENSGGOP00000002471 9606.ENSP00000350708 ENSP00000396975 gi|4506387|ref|NP_002865.1| ENSP00000350708 ENSP00000350708 NP_002865.1.87134 NP_002865.1.92137 XP_003810947.1.60992 XP_018889482.1.27298 ENSGGOP00000002471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]