SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018891208.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018891208.1.27298
Domain Number 1 Region: 292-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-42
Family SPRY domain 0.00008
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-27
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.23e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018891208.1.27298
Sequence length 493
Comment PREDICTED: tripartite motif-containing protein 5 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAQEYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKRLTKSETEMVQQTQSVRELISDLERRLQ
GSVMELLQGVDGVIKRMENVTLKKPETFPKNRRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDMRQVSSPKPQIIYGAQGTRYQTFMNFNYCTGILGSQSITSGKHY
WEVDVSKKSAWILGVCAGFQPDATCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHT
PSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCRVPMTLCSPSS
Download sequence
Identical sequences G3S2X6
XP_018891206.1.27298 XP_018891207.1.27298 XP_018891208.1.27298 ENSGGOP00000022424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]