SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018891925.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018891925.1.27298
Domain Number 1 Region: 86-233
Classification Level Classification E-value
Superfamily L domain-like 6.8e-28
Family Internalin LRR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018891925.1.27298
Sequence length 542
Comment PREDICTED: leucine-rich repeat-containing protein 56 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDPGWDRSRGPRPSTSSVRVRELSWQGLHNPCPQSKGPGSQRDSLGEQLVEEYLSPARLQ
ALARVDDLRLVRALEMCVDTREGSLRNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQV
LWLAHCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRY
LQLCPRLVMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPP
APLRLSQDWFAVKEAIKKGNGLPPLDCPRGAPIWRLDPELSLPETQPRASRPWPFSLLVH
GGPLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPG
DPAASTSTPEPDPTDSSDFLALAGLRAWRERGVRPLPCRHPESQQEGAVAPWGPRRVPEE
QVHQAEPKTPSSPPSLASESSGTSSQHLVPSPPKHPRPRDSGSNSLRWSTDLQSRGRRLR
ALGSWGPGLGDGVAAVPVLRALEVASGLSPRAQGRPGPKPAPDAAARPPRAAELSHPSPI
PT
Download sequence
Identical sequences G3RHE9
ENSGGOP00000015068 XP_018891924.1.27298 XP_018891925.1.27298 XP_018891926.1.27298 ENSGGOP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]