SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018893682.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018893682.1.27298
Domain Number 1 Region: 245-500
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-63
Family Eukaryotic proteases 0.000000142
Further Details:      
 
Domain Number 2 Region: 63-180
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-24
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 207-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000058
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018893682.1.27298
Sequence length 504
Comment PREDICTED: complement C1r subcomponent-like protein [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MPAPRVWGKYLWRSPHSTGCPGAMLPATAARPHLALPATHRWWLLLWGVLQACPTRGFVL
LAQELPQQLTSPGYPEPYGKGQESSTDIKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISA
GGSDPSQFCGQQGSPLGRPPGQREFVSSGRSLRLTFRTQPSSENKTAHLHKGFLALYQSV
AVNYSQPISEASRGSEAINAPGDNPAKVQNHCQEPYYQAVAAGALTCATPGTWKDRQDGE
EVLQCMPVCGRPVTPIAQNQTTRGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAH
TIYPKDSVSLRKNQSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESQNFSGDIALL
ELQHSIPLGPNVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACN
AWLQKRQRPEVFSDNMFCVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWGIGCG
EGYDFYTKVLSYVDWIKGVMNGKN
Download sequence
Identical sequences XP_018893682.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]