SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018894161.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018894161.1.27298
Domain Number 1 Region: 173-198,255-462
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-58
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family Tetramerization domain of potassium channels 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018894161.1.27298
Sequence length 529
Comment PREDICTED: potassium voltage-gated channel subfamily A member 6 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITP
GEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID
LVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV
Download sequence
Identical sequences A0A2I2YQ40 P17658
ENSP00000280684 ENSP00000280684 ENSP00000408321 NP_002226.1.87134 NP_002226.1.92137 XP_004052580.1.27298 XP_005253743.1.92137 XP_011519257.1.92137 XP_016874759.1.92137 XP_016874760.1.92137 XP_016874761.1.92137 XP_018894161.1.27298 XP_018894162.1.27298 XP_018894163.1.27298 ENSP00000280684 ENSP00000408321 9606.ENSP00000280684 gi|4504821|ref|NP_002226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]