SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018894594.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018894594.1.27298
Domain Number 1 Region: 40-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000919
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  XP_018894594.1.27298
Domain Number - Region: 1277-1285
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018894594.1.27298
Sequence length 1463
Comment PREDICTED: protein SCAF11 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKKKTVCTLNMGDKKYEDMEGEENGDNTISTGLLYSEADRCPICLNCLLEKEVGFPESCN
HVFCMTCILKWAETLASCPIDRKPFQAVFKFSALEGYVKVQVKKQLRETKDKKNENSFEK
QVSCHENSKSCIRRKAIVREDLLSAKVCDLKWIHRNSLYSETGGKKNAAIKINKPQRSNW
STNQCFRNFFSNMFSSVSHSGESSFTYRAYCTEFIEASEISALIRQKRHELELSWFPDTL
PGIGRIGFIPWNVETEVLPLISSVLPRTIFPTSTISFEHFGTSCKGYALAHTQEGEEKKQ
TSGTSNTRGSRRKPAMTTPTRRSTRNTRAETASQSQRSPISDNSGCDAPGNSNPSLSVPS
SAESEKQTRQAPKRKSVRRGRKPPLLKKKLRSSVAAPEKSSSNDSVDEETAESDTSPVLE
KEHQPDVDSSNICTVQTHVENQSANCLKSCNEQIEESEKHTANYDTEERVESSSSESCAQ
DLPVLVSEEGEVKKLENTGIEANVLCLESKISENILEKGGDPLEKQDQISGLSQSEVKTD
ICTVHLPNDFPTCLTSESKVYQPVSCPLSELSENVESVVNEEKMTESSIVEITEHKDFTL
KTEELIESPKLESSEGEIIQTVDRQSVKSPEVQLLGHVETEDVEIIATCDTFGNEDFNNI
QDSENNLLKNNLLNTKLEKSLEEKNESLTEHPRSTELPKTHIEQIQKHFSEDNNEMIPME
CDSFCSDQNESEVEPSVNADLKQMNENSVTHRSENNMPSSDLADEKVETVSQPSESPKDT
IDKAKKPRTRRSRFHSPSTTWSPNKDTPQEKKRPQSPSPRRETGKESRKSQSPSPKNESA
RGRKKSRSQSPKKDIARERRQSQSRSPKRDTTRESRRSESLSPSRETSRENKRSQPRVKD
SSPGEKSRSQSRERESDRDVQRRERERRTRKWSRSRSHSRSPSRCRTKSKSSSFGRIDRD
SYFPRWKGRWVNDGWRCPRGNDRFRKNDPEKQNENTRKEKNDIHLDADDPNSADKHRNDC
PNWITEKINSGPDPRTRNPEKLKESHWEENRNENSGNSWNKNFGSGWVSNRGRGRGNRGR
GTYRSSFAYKDQNENRWQNRKPLSGNSNSSGSESFKFVEQQSYKRKSEQEFSFDTPADRS
GWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQQVDG
SQLPINMMQPQMNVMQQQMNAQHQPMNIFPYPVGVHAPLMNIQRNPFNIHPQLPLHLHTG
VPLMQVATPTSVSQGLPPPPPPPPPSQQVNYIASQPDGKQLQGIPSSSHVSNNMSTPVLP
APTAAPGNTGMVQGPSSGNTSSSSHSKASNAAVKLAESKVSVAVEASADSSKTDKKLQIQ
EKAAQEVKLAIKPFYQNKDITKEEYKEIVRKAVDKVCHSKSGEVNSTKVANLVKAYVDKY
KYSRKGSQKKTLEEPVSTEKNIG
Download sequence
Identical sequences G3RFZ5
XP_018894594.1.27298 ENSGGOP00000014528 ENSGGOP00000014528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]