SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018894965.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018894965.1.27298
Domain Number 1 Region: 225-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,88-160
Classification Level Classification E-value
Superfamily POZ domain 1.31e-28
Family Tetramerization domain of potassium channels 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018894965.1.27298
Sequence length 638
Comment PREDICTED: potassium voltage-gated channel subfamily C member 2 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS
LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences A0A024RBA5 A0A2I3HKC4 A0A2I3LJN5 A0A2I3SQI9 A0A2J8W1D6 A0A2K5I679 A0A2K5MAP0 A0A2K5V4P9 A0A2K5XC15 A0A2K6CMV8 A0A2K6NXB8 G3S3N7 H9EP98 Q96PR1
ENSP00000376966 ENSGGOP00000003820 9600.ENSPPYP00000005447 9606.ENSP00000376966 ENSGGOP00000003820 ENSP00000449253 ENSP00000449253 ENSNLEP00000005549 NP_631875.1.87134 NP_631875.1.92137 XP_002823573.1.23681 XP_003259605.1.23891 XP_003313895.3.37143 XP_003832945.1.60992 XP_004053634.1.27298 XP_005571615.1.63531 XP_005571616.1.63531 XP_008956612.1.60992 XP_010360956.1.97406 XP_011725431.1.29376 XP_011725432.1.29376 XP_011784740.1.43180 XP_011850704.1.47321 XP_011905127.1.92194 XP_011905128.1.92194 XP_015007747.1.72884 XP_015007748.1.72884 XP_016779345.1.37143 XP_018894965.1.27298 ENSNLEP00000005549 gi|21217563|ref|NP_631875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]