SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018895277.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018895277.1.27298
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018895277.1.27298
Sequence length 196
Comment PREDICTED: SPRY domain-containing protein 7 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences G1QUC7 G3SIB6 H2R1A5
9598.ENSPTRP00000042045 ENSNLEP00000004547 ENSNLEP00000004547 XP_003809860.1.60992 XP_012362308.1.23891 XP_018895275.1.27298 XP_018895277.1.27298 XP_522757.2.37143 ENSPTRP00000042045 ENSPTRP00000042045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]