SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018895500.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018895500.1.27298
Domain Number 1 Region: 228-275
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.57e-16
Family TRASH domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018895500.1.27298
Sequence length 667
Comment PREDICTED: zinc finger MYM-type protein 5 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDKCSVGGLEFTEQTPALLGNIAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDVV
FIESIQPPSVSAPAIADQRNFIFASSKNEKPQGNYSVIPPSRDLASQKGNISETIVIDDE
EDIETNGGAEKKSSCFIEWGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGD
LFQNGEFATHHSPDSWISQSASFPSNQKQPGVDSLSPVALLRKQNFQPTAQQQLTKPAKI
TCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVIL
PVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHEVSVNNVTHKLCS
NHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMMETK
SKKLTASENRKRNAFREENEKQLYGSSNTLMKKIEGIPEKKEKTSQLQLSVECGTDTLLI
QESVNLPPPSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVP
PQVRNFNFPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQ
LKNENGCKDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKKNKAIDAAERRLYENEKND
GVLLLYT
Download sequence
Identical sequences G3SAR5
ENSGGOP00000025188 XP_018895498.1.27298 XP_018895499.1.27298 XP_018895500.1.27298 ENSGGOP00000023119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]