SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018949616.1.5815 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018949616.1.5815
Domain Number 1 Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000583
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 31-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000754
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 69-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000405
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 4 Region: 110-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000263
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018949616.1.5815
Sequence length 226
Comment PREDICTED: protein eyes shut homolog [Cyprinus carpio]; AA=GCF_000951615.1; RF=representative genome; TAX=7962; STAX=7962; NAME=Cyprinus carpio; AL=Chromosome; RT=Major
Sequence
MIVGLIPREHAYCNYDCLCLPGWEGEFCQWKTDECSSNPCKNNTTCTDLLNAYRCTCPRG
WTGLDCGEDVKECSSSPCLNRAHCVESDVPGEFSCTCPPFFTGLLCEQAYDPCDLQHNPC
LHNSTCRAKSDGTALCVCPAGFSGQRCEEDINECASNPCQNRGVCQDLVNGFQCNCVTRY
FGTLCNLDVNEYEASPCLHDSVCINKLHMWDSYVSAVLASQGNGAS
Download sequence
Identical sequences XP_018949616.1.5815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]