SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018988556.1.12885 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018988556.1.12885
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily HMG-box 8.77e-20
Family HMG-box 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018988556.1.12885
Sequence length 73
Comment hypothetical protein BABINDRAFT_21495, partial [Babjeviella inositovora NRRL Y-12698]; AA=GCF_001661335.1; RF=representative genome; TAX=984486; STAX=45609; NAME=Babjeviella inositovora NRRL Y-12698; strain=NRRL Y-12698; AL=Scaffold; RT=Major
Sequence
RPKNAFILFRQAKQLEVLIGSSSIIPNREVSRELGRRWRNLPFEEKQIWLKLAEEEKKAH
NLKYPDYKYQPKK
Download sequence
Identical sequences A0A1E3R002
jgi|Babin1|21495|gw1.1.881.1 XP_018988556.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]