SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019012155.1.53998 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019012155.1.53998
Domain Number 1 Region: 191-340
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-32
Family cAMP-binding domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 334-462
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-27
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 5-38
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000241
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019012155.1.53998
Sequence length 475
Comment cAMP-dependent protein kinase regulator [Kwoniella pini CBS 10737]; AA=GCF_000512605.1; RF=representative genome; TAX=1296096; STAX=453459; NAME=Kwoniella pini CBS 10737; strain=CBS 10737; AL=Scaffold; RT=Major
Sequence
MSTTWTNILNDLNRDVARDQPKDVIQWGADWFQGKLRQERQNSKPSSTGRKGAPGSLGFS
APGVASDLGPHALSPFSEQGPADSPFGAGGPRRATVPTGSNPQQQHQPIFSPSFGSPGPG
TDNSPFSESASSFPPSSGAPTFNSSPFGAINNTINEEAHDEPPIPSYALGRRTSVSAESL
DEATPNPNSNNNAIPSFPKTEEQLQRIRQAIKPNFLFRNLDEEQETDVLAAMKETTISAG
EMIIEQGAAGDYFYIVESGELDIFVKKDGQVIDPEKGDRPLLGKKVATCKEGSSFGELAL
MHNAPRAASILSITPCTLWALDRVSFRTILLDHTSRKRRLYESFLSEVQILQSLQPQERA
KIADVLESRTFNQGEDVIKQGEAGDEFFLIESGNAIAIKRGEDGRESVVKRYNKGDYFGE
LALLNKQTRAATIRADGSGPLRVAFLGEQAFTRLLGPVKDIMARSVNEIYGFSTR
Download sequence
Identical sequences A0A1B9I5Y9
XP_019012155.1.53998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]