SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019064160.1.5607 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019064160.1.5607
Domain Number 1 Region: 62-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 269-384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000406
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 473-510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 183-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 229-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 434-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019064160.1.5607
Sequence length 787
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 3 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence
MYTTSMKSPPPGHGHPWLDLFSLWGRPVLKPWGGXQAAPPSTCFPPKGGACISQPPLLTA
ACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSL
DWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKL
GQVSCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSG
ARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPLDLH
CTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQG
RLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDNDSSGDQGCFSEPQRCDGW
WHCASGRDEQGCPACPPDQYPCEGGSGLCYAPTDRCNNQKSCPDGADEKNCFSCQPGTFH
CGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFK
LYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQN
LRTAMRRQMRRHASCRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQ
PGPGATPGPTAPCMDTGSPRPPGDGPPSAPGHTLEVGPSVPLPSGLQDPEYRPVDRDRKA
CRDPLVDSPATVDTAPELCSAQDPQPQAPTAISIQGSHSEPLGVRRSPLPPCSPMLEASD
DEALLVC
Download sequence
Identical sequences XP_019064160.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]