SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019126821.1.61708 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019126821.1.61708
Domain Number 1 Region: 31-513
Classification Level Classification E-value
Superfamily Sema domain 2.49e-100
Family Sema domain 0.00067
Further Details:      
 
Domain Number 2 Region: 1382-1505,1671-1855
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.04e-33
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 857-947
Classification Level Classification E-value
Superfamily E set domains 0.000000000000229
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 4 Region: 948-1038
Classification Level Classification E-value
Superfamily E set domains 0.000000000153
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 1039-1120
Classification Level Classification E-value
Superfamily E set domains 0.000000000182
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Domain Number 6 Region: 511-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000453
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019126821.1.61708
Sequence length 1895
Comment PREDICTED: plexin-D1 isoform X2 [Larimichthys crocea]; AA=GCF_000972845.1; RF=representative genome; TAX=215358; STAX=215358; NAME=Larimichthys crocea; AL=Scaffold; RT=Major
Sequence
MPPSLAIAVLLLGVLALETHRSASALHIEQAFASPNQTNNFVVDPVSRKVYLATVNTVYQ
LNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPKKPSGPESK
KLTESYIQMPLQCGFNGNIYNRLLSVYPAEIHGDDGRSSEPYLFGVFSKGDRKSALCAFK
FEDIEEEIRQGRRSCSNSPSSDVQVLDSVIQGSGAACVQKGTLVLQREQLDCGAAHLQHP
LALRRPLRAIPLVEYLGLTSVSVDYVHNHTVVFLGTTNGRLRKLTLLANMTLANQWTLKL
PAIEAVHHIMTFDPSDSNFLYLMTSHHMLRVKVAECDQWKSCSDCLGAGDAHCGWCTLEN
RCTIQKECAQELLARSWISMGEGPQQCPSMTLTPPEISISADIKDVGILINGSVPDLDGS
RVECEYGPGVSTAATVHLDYGPAQIQTCPLLPRENYQAIPSGTDHLTVSVAIKVNGTSVV
SGSFIIYDCEKTGAIHPKTSCVSCLSTRWKCYWDQENHLCVSKDDSKHNLLENAASCPSL
VASEVPPSPSGMAQDFTLSLSNIQEGEELECDFGTEQQYEATWLNSSTVKCSGVTLSTNQ
RSQIYHLNLRRRGYFSGRGEDIFVDSPQPMRVEVYNCKVGSSDCSQCWGREDQGHLCGWC
ENSCRPRDDCQPISDQCPSPEIHKIYPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGGVP
CTLQPELYTVSVELVCVTGSSSHDRTDIVQLDVVQGGKGKSKESFSYLVPKLLSMNPRKG
SRAGGTRVSIQGEHLDIGSQIKVMVNNTLECIIIEKRDETIECTMPQALQPHTDSVAVCV
EFENVPCQSELSTTYTYEKNPIISFIHPQKSYLSGGRIITVTGQGFDLVQSVTMQVLGIG
QTPCKVDSNSMISCLSHASSQSQLTSVQFFLNGVLYTGDSPSSFDSDEEEEEYQKGHFRL
EYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLELVPEEYSVMIGPYPCNISFHNDQ
LFHCTISGLLSSSERELPVIVQVGNFRHTIAKVQLGGSELAIVVSIVVCCVLLLLCTVAL
VVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLE
YKQFVTRTFFPKMCSDYEKSLVQPAYENDGLGPRALPETHPLLQDWQATNSTRPNIEEGI
TLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSI
DAITGKARYTLNEEWLLRENVEAKPQNMNVSFQGCGMDSLSVRVMHTDTICQVKEKILEA
FYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASL
AMSLKDKKENTLGRVKDLDTEKYVHLVLPHDELMETKKSHRQSHRKKVLPEIYLTRLLST
KGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPE
YKKRVQCYYQQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVS
ALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_010755096.2.61708 XP_019126821.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]