SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019128173.1.61708 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019128173.1.61708
Domain Number 1 Region: 254-351
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 175-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000238
Family I set domains 0.048
Further Details:      
 
Domain Number 3 Region: 416-704
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000000418
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000499
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 95-172
Classification Level Classification E-value
Superfamily EF-hand 0.000000000233
Family Calmodulin-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019128173.1.61708
Sequence length 762
Comment PREDICTED: follistatin-related protein 4-like isoform X3 [Larimichthys crocea]; AA=GCF_000972845.1; RF=representative genome; TAX=215358; STAX=215358; NAME=Larimichthys crocea; AL=Scaffold; RT=Major
Sequence
MAESGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLERRRIYVVHSKDCFFKGN
ACTMSEYNRLKSMLLDIQPKVLKTGEHSQQRDMEEKRALVDTMFKYLDGDQDGRLVSDEL
ERISMKEHLEDSLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVVQLSLAEDQQISVSTV
TVGLSAVLTCAIQGTLRPPIIWKRNGIILNFLDLEDINDFGDDGSLYITKVTTIHMGNYS
CHAYGYEDLYQTHVLQVNVPPVILVYPETQAQEPGVSASLHCHADGIPNPKLLWLKNGMD
LQPRSSKQLSLIANGSELFIGSVRYEDTGAYTCIAKNEVGVDEDISSLFVEDSAKKTLAN
ILWREEGLSVGNMFYVFSDEGITVLQPSECEIRRHMKRTERIVATYEEMCPKGEGVSPQH
CVWSSAVNIRDKYIYVSQPLLSRLLVVDIQAQKVVQAVTTDPYPVKMLYDKSHDQVWVLT
WGDMDRTHPTLQVIPQASVGEVHHAIRTTFQRVSDFFIPPTNLIITHVRFAFVFLKNEPA
IHKIDLETFHRVKTISLKNYSCIPLNMAYTHLSGFYFVQCQSKSHLQAPPQLLIDSVTDT
VIGPNLNVTGQPFVSPDGRYIVTPDPQSSKLIVQTVSFQGELGLNQELDEPVAVSDLAFQ
PSFTESNQHVVVATSGSGTDLLFADLSSGHTEVLPSLKEPLGSQAWPWGGPNRVVVSSGL
FGQYLVTPSAESLFVLNGKQRTPHCEVSDIKRGNTVVWVGEV
Download sequence
Identical sequences XP_019128173.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]