SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019289139.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019289139.1.44245
Domain Number 1 Region: 53-549
Classification Level Classification E-value
Superfamily Sema domain 8.63e-100
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1412-1537,1703-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000292
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.051
Further Details:      
 
Domain Number 4 Region: 889-981
Classification Level Classification E-value
Superfamily E set domains 0.000000000000152
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 1067-1149
Classification Level Classification E-value
Superfamily E set domains 0.00000000000408
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 552-604
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000301
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019289139.1.44245
Sequence length 1927
Comment PREDICTED: plexin-D1 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPLSARAAAASPLPPRPPFRAPSPCPLLPLLLLLGAARAGALEIQRRFPSPT
PTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHP
RRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFP
SMLNVAANHPNASTVGLVLPPAAGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPE
IAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPPPGAPSYA
YLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSR
LVSVFPARELLFAVFERPQGSPASRLTPAALCAFRFADVQAAIRAARTACFXEPWPDVVS
TLEKLIQGSEPRCDILLLFQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLSSVAVA
SVSNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMT
SHQMARVRVAACAVHATCGDCVGAADAYCGWCALETRCTLQQDCANYSQQHFWTSASEGP
SRCPAMTVLPAEIDVHQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQ
IAYCNLLPRDQFPPFPPHQDHVIVEMSVRVNGRNIVRANFTIYNCSRIGQVYPHTACTSC
LSAQWPCFWCTQQHACVSNQSRCEASPNPMSPQDCPQILPSRLAPMPTGSLQSIPVHLAN
AAFQGAALECSFGPEEIFEAVWVNESTVHCNQVVLHTTQKSQMFPLSLQLKGQPARFLDS
PDPITVEVYNCAMGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGTCPAPEIRAIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLADRYMVSEEIVCATGPAPEAF
SDVVTVNASKEGKSRERFSYVLPQVQFLEPDKGPKAGGTRITIHGSDLHVGSELQVLVND
TEPCTELVRMDTSITCTVPEGALPAPVSVCVRFERRGCVHSNLTFQYMQNPVITAISPRR
SPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYTDEAAVAEELLDPQEARRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLV
IHKEQDSLGLESHEYRIKIGQVACDIQIVSDKVIHCSVNESLGTAEGQLPITIQVGNFNQ
TIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQI
REEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTL
NSQGSAPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAV
RDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWM
SICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNL
NVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSY
ILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVL
PTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVK
YFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVI
AQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLA
EESRKYQNEFNTNVAMAEIYKYAKRYRTQIMTALEANPTARRTQLQHKFEQVVALMEDNI
YECYSEA
Download sequence
Identical sequences XP_019289139.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]