SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019293341.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019293341.1.44245
Domain Number 1 Region: 96-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000605
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000458
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019293341.1.44245
Sequence length 198
Comment PREDICTED: zinc finger protein 581 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MLVLPSPPCPQPLALPSAEAMEAPPSRTGRSPEPGPSSSTGPPQPSSPPRPNHYLLIDTQ
GIPYTVLVDQESEREPGADGASAQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDT
CGKAFKRASHLARHHSIHRAGGGRPHGCPLCPRRFREAGELAQHSRVHSGERPFQCPHCP
RRFMEQNTLQKHTRWKHP
Download sequence
Identical sequences M3WF76
XP_003997440.1.62641 XP_006940889.1.62641 XP_011287855.1.62641 XP_014934518.1.86478 XP_015392381.1.5354 XP_019293341.1.44245 XP_019293342.1.44245 XP_019293343.1.44245 XP_019674656.1.62641 ENSFCAP00000010683 9685.ENSFCAP00000010683 ENSFCAP00000010683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]