SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019294167.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019294167.1.44245
Domain Number 1 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 624-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 35-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 291-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000197
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 231-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000747
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 130-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000432
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number 12 Region: 191-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000399
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019294167.1.44245
Sequence length 722
Comment PREDICTED: zinc finger protein 132 isoform X3 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MHFYPSAHGSSFLSLGFPRCRTEPICWPSSLAVSSLQSPVTFEDVAVYFSKEEWGLLDAG
QRDLYHNVMLENFQLMTSLGCWHGVEDEGAHSKKNASIQGMLQVRIPTANPSTQKADTCD
MCGPFLKDILHLDEHQRTYPENTLYTCGACGREFWFSVNLHQHQEEHSREKPFRWDKDRD
SFVEHSIVLLSEKPFTCGEDGEDALDSHDLFQHPAIESSGKPYRSTECRKAFSHSSNLEQ
LLEVHSTQELFKCSNCGKVFQKSSTLLNHLRIHSEETLFRCPTVENSLEEKSTLVNHQKC
HNEETCHVCKECEKTFSHPSKLRKHQKFHTGVKHYKCNDCGKTFSHKLTLVHHQRIHTGE
RPYECSECGKVFNNRSHLTRHEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYE
CNQCGKAFSRSSALIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSEC
GRDFSQSSHLLRHQKVHTGERPFECSECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAF
SRSSSLIQHWRIHTGERPYECSECGKAFAHSSSLIEHWRVHTRERPYECSECGKFFSQNS
ILIKHQKVHTGERPYQCSECGKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSHLVR
HQRVHTRERPYECSQCGKAFSERSTLVRHQIVHTRERTYECGHCGKIFSRLCNLAQHKRI
HT
Download sequence
Identical sequences XP_019294167.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]