SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019295594.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019295594.1.44245
Domain Number 1 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 148-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-20
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 12 Region: 82-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019295594.1.44245
Sequence length 697
Comment PREDICTED: zinc finger protein 420-like, partial [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
CFLLQGLLTFRDVAIEFSQKELRCLNHSQWELYRDVMLENYGHLHFLGLVVSKPDLVIFL
EHKKDVWAMKRKETVATHPGIKPYECEECGKSFKLCPTLTQHKLTHIGEKPYQCNECGNT
FRHHSQLSEHNRIHNEEKPYQCKECGKAFNWRTALRRHHRIHTGEKPYQCKQCGKVFRYF
SNFIKHRRIHTGVKPYKCKECGKAFNWHSALKTHHRIHSGGKPYQCKQCGKAFTRPSALT
EHCRIHTGEKPYQCKECDEGFYWHSALKLHQRIHSGEKPYQCKECGKAFSRASVLTEHHR
IHTGQKPYQCKECGKAFHRLSALTMHRRIHTGVKPYQCKECGKAFFHQEHLDVHHRVHTG
QKPYQCKERGKAFGFVSNFIQHRRIHAGVKPYKCKECGKAFSRQAYLNVHHSIHIGEKPY
QCKECGKAFKVHSEHTRHHKIHSGEKPYKCKECGKAFNKQSSLRQHEGIHTGQKPYQCKE
CGKAFNWQSALKRHHRIHSGEKPYQCKECDKAFSRQEHLDMHHRVHTGQKPYQCKECGKA
FSRQAHLNVHHRIHTGEKHYQCKECGKAFKGHSELTRHHKIHSGEKPYQCKQCGKAFNCQ
SALKRHLRIHSGEKPYQCKECGKAFKGHSELTRHHKIHSGEKPYQCKECGKAFNSQSALK
RHRRIHSGEKPYQCKECGKAFTHHSSLTNHHKIHTGD
Download sequence
Identical sequences XP_019295594.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]