SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019309060.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019309060.1.44245
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019309060.1.44245
Sequence length 249
Comment PREDICTED: pleckstrin homology domain-containing family F member 2 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MVDRLANSEANTRRINIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMATCQPTRSDSYSQSLKSPLNDVSD
DDDDDDSSD
Download sequence
Identical sequences A0A287ASA9 M3WVQ3 M3Z4K3 U6CRZ6
XP_004000035.1.62641 XP_004768596.1.14098 XP_007073343.1.5354 XP_007073344.1.5354 XP_007073345.1.5354 XP_007073346.1.5354 XP_011289706.1.62641 XP_014937971.1.86478 XP_014937972.1.86478 XP_014937973.1.86478 XP_014937974.1.86478 XP_015390919.1.5354 XP_015390927.1.5354 XP_015390934.1.5354 XP_016064592.1.3490 XP_016064593.1.3490 XP_016064594.1.3490 XP_019309056.1.44245 XP_019309057.1.44245 XP_019309058.1.44245 XP_019309059.1.44245 XP_019309060.1.44245 XP_019309061.1.44245 XP_019678474.1.62641 XP_019678475.1.62641 XP_020944738.1.46622 XP_020944739.1.46622 ENSFCAP00000018440 ENSMPUP00000018515 ENSMPUP00000018515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]