SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019320179.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019320179.1.44245
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-64
Family Eukaryotic proteases 0.000000165
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-23
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 189-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000009
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019320179.1.44245
Sequence length 487
Comment PREDICTED: complement C1r subcomponent-like protein isoform X1 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MSSSRCLVSEWGNYLWRSPHSTSCQGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPG
YPEPYVKGQESSSDIEAPEGFAVRLVFQDFDLEPSQDCGQDSVTITASGMDPNRFCGQQG
SPLGSPPGQREFVSPGNRLRLTFRAPASSQDRTTGLHRGFLALYQAVGVNHSRPSGGSEA
ISIAEDNSSKIQNHCQEPYYQAVPAGALPCTTQGLWKETQDREELPRCEPVCGRPLTPIS
QNQEALGSSKAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSVFPWKNRRVD
VFLGHTSLDEMLRLGSHPVSRVVVHPDYRQNESHDFNGDIALLELQHSVPLGPSLLPVCL
PDSETLYRSGVLGYVSGFGVERGWLTTELKYSRLPVAPRAACQAWLQEKQRSEVFSDNMF
CAGDEMRHQSVCQGDSGGVYVVWDERAHHWVATGIVSWGVGCGKGYGFYTKVFNYLDWIK
GVMGGKD
Download sequence
Identical sequences XP_019320179.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]