SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019367177.1.87953 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019367177.1.87953
Domain Number 1 Region: 436-654
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000504
Family Clathrin adaptor core protein 0.073
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000567
Family APC10-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019367177.1.87953
Sequence length 926
Comment PREDICTED: centrosomal protein of 104 kDa isoform X2 [Gavialis gangeticus]; AA=GCF_001723915.1; RF=representative genome; TAX=94835; STAX=94835; NAME=Gavialis gangeticus; AL=Scaffold; RT=Major
Sequence
MPHKIGFVVLSSSGHEDGFSAKELMVHAPTVNGWRSPRLCQYPQEIVLQMVERCRVRKLQ
LLAHQYMISSKIEFYISENLPEYFAPYQSEQFRRLGYVSLSDNEKTGYKARELKSVYVDA
VGQYLKLTFHKNYVNRYNLYGQVALVAINIIGEPADSTNDNNNPSREKLIDHYLGSNSED
PALDGTYIGKPDSISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKKKKQQMEEYRLKVYQQLELHNLMDPELMIR
RLPELPLEPVIHSVSPQQKRSTHSPQHEKTEPEKVEPLPQEKPTEPTSHEPVVPHQSPPP
VVQPPASVEGFPKINVEFLPYDERPLPAIRKQQEEAFAYLEPEMNEEYTDGTPRSGITGE
PEPLTEKALREASPAIEVFGEALVAGAYSKTWSYREDALLAIYKKLMEISVSTPKEDLKN
MLRAAVFLIRRATKDIVSSVFQASLKLLKMIITQYIPKHKLGKLETAHCVDRILPNLLSR
TGDSSTRLRVVASNFIQEMALCNEVKPLQIIPIHLVHPLKPNSPTHLAMSQVELVERLLK
NLGTENSGFTVDNIMRFATGALEHRVYEVRDTALRIIFGMYRQHRTVILNYLPPDDANTR
KNVLYKTLFDGFTKIDGKLTEAEIKAQKKAATEEAEKQKKEQIKVLQGQLATLKEIQAEV
QAGKEKENDFQKLKNQGDQLNKATLSAATEISDDHSSVTNYLDNLCIFCGERNESFTEEG
LDLHYWKRCPMLTRCEHCKQVVEIASLTEHLLTECDKKEGFGKCQRCSEALPKEELPKHI
KGKACNPAKPEKVANHCPLCHENFTPGEEAWKSHLMGKDGCKMNLRRVHTTNKTLLMQPG
KAGGLAVSKPVPTGAKLRSPTIGTVQ
Download sequence
Identical sequences XP_019367177.1.87953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]