SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019496583.1.44202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019496583.1.44202
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 3.5e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 123-243
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019496583.1.44202
Sequence length 752
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X3 [Hipposideros armiger]; AA=GCF_001890085.1; RF=representative genome; TAX=186990; STAX=186990; NAME=Hipposideros armiger; AL=Scaffold; RT=Major
Sequence
MQHGSVPNSPPFFAPPTSLPCVTREGWSGLSSGGGAGRSAGVTATAAADGWKGRLPSPLV
FLPRSARCQARRRRRLVGRTSSLLQHPSAPELALFLSPSLDISPRGLGASSGAAQGAGAG
LLLVCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADVVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKVFPQVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDNWQKRLDREAEKRRRLEEAYK
NAVTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTP
MLSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPAFTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_019496583.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]