SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019502376.1.44202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019502376.1.44202
Domain Number 1 Region: 259-439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-30
Family Laminin G-like module 0.049
Further Details:      
 
Domain Number 2 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 628-768,798-816
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000428
Family Zinc protease 0.079
Further Details:      
 
Domain Number 4 Region: 1590-1648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000103
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number 5 Region: 1469-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Domain Number 6 Region: 539-631,720-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000415
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019502376.1.44202
Sequence length 1791
Comment PREDICTED: pappalysin-2 [Hipposideros armiger]; AA=GCF_001890085.1; RF=representative genome; TAX=186990; STAX=186990; NAME=Hipposideros armiger; AL=Scaffold; RT=Major
Sequence
MMHLKILRLSLVMLAGWALGTASSEPGWTRKRSLAQRGHLNQVPSEGERCWLGAKVRRPR
AAPQHHLFGVYPSRPGSYLRPYPVGDQGPHHAGCGKPAAEGMAGSRAPPDPTARAGVSNE
AEHPAVPWVGDGPIGQSELPGDDDTHLDDGGSKEALGEAGTQDCAATAATVPTSFAHRKE
PKPATRRKGRAKTRRRRQVVKGQAEGVRRDPDASPQHFQPWPKRPLTPGVRTSPSEDSTQ
HGEGDPFREAETSNPHGRGLPVLYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGKDIGREDPRFFFSLRTDRVKKATIVIGRSRYQ
PGTWTHVAATYDGRRMALYVDGTQVASSLDQSGPLNSHFMASCRSLLLGGDSSEKGRYFR
GHLGTLVLWSTALSQSHLQHSPQHPSMGEELTTLILTASFEPLEEQWAPFRDERYPQLEV
LQGFEPEPEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKAIRYQVVNICDDEGLNP
TVSEEQISRQHEALNEAFGRYNITWQLSVHRVHNSTLRHRAVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVADVHKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAVSHLGGVVLNPA
YYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKS
KLCQDPEPINDTCGFTPFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQS
RKPAPIPIPPVVIGQTSGSLTIHWLPPISGVVYDRVLGSVCGACTEDGAFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHTNMTVPCPAEGCSLELLFQHP
VQADSLTLWVTYLSMDSSQALFDMEILLEQQESVHLGSFDTFCDTPLTIKLHVDGKVVGV
KVYTFDERMEIDAALLTSQPQSPLCSGCRPVTYQVLREPPFASGSPMVVTQPHRKFTDVE
VTPGRMYQYQVQAVAGAELGEASPSLSHVHGAPYCGDGKVARSLGEECDDGDLLSGDGCS
RACALEEGFACMGEPSLCYIYEGDGICEPFEKETSLMDCGLYTPDGYLDQWAIQAYSSHE
DKNKCPVSLVTGEPHSMICTPYHPDLPEHRPLTGWLPCVTSGNRPRDEGREQQEGSLERE
EEVWLKVYFGRPGVVTAIFIFLTSDGPVSGKHQRPTVTLHLTDFSGSNHSLGTHELSCQH
NPLVINVTHDPNILFHRTTSLLLNFSSPLVGISAVALRTPSHTSPSAPSNCIPGHKGQSH
QGLSGVHQTYGEQSSCSPLLLDHAEAVNCTSDGPGHMKCAITCQRGFALQTSNGQYLRPL
KREILLTCSCGHWDRAVGCMPLDCGVPDPALVNYATFSCSEGTDFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEAYCKLECDAPPVIQNADLLLPRCLQGRHDVGSICRYECKPGY
YVAGSTENKVRNKFLKIQCLEDGTWQQGSCVPVMCEPPSPVFQGMYECTKGFELNSQCVL
NCNQESKRLPILCTKEGLWTEEFKLCEKLQGECPPPPSELNFVEYKCEQGYRIGAVCSPS
CIIPPNDPVILPENITADTLEHWMEPVKVQSIVCTGRRQWHPDPVLIHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences XP_019502376.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]