SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019510082.1.44202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019510082.1.44202
Domain Number 1 Region: 68-181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 276-390
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 479-516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 189-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 235-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 440-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019510082.1.44202
Sequence length 794
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X2 [Hipposideros armiger]; AA=GCF_001890085.1; RF=representative genome; TAX=186990; STAX=186990; NAME=Hipposideros armiger; AL=Scaffold; RT=Major
Sequence
MTGWAQRFLGGVRFQRPLRGVSNLPSQALLGTEASISVNIVLSGRLSSAVPALGEASTSQ
PPLLTAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEE
SHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLS
YIRGKLGQASCQSDEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGG
TFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAAR
GPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVS
LEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDMSDTGEQGCFSEP
QRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSC
QPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIA
LGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQ
ASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVL
GDGLLQPATGAAPDPQAPLTDTGSPGAAGDGSPSAPGHTPEVGPSMPPSSGLRDPEYRPV
DKDRKACRDPLVDSPAPVDMLQEACSAQDPHPMTPTASNTLGPHPPEPLGVCRSPQLPCS
PTLEASDDEALLVC
Download sequence
Identical sequences XP_019510082.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]