SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019510084.1.44202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019510084.1.44202
Domain Number 1 Region: 56-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 264-378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 467-504
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 177-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 223-262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 428-465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019510084.1.44202
Sequence length 782
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X4 [Hipposideros armiger]; AA=GCF_001890085.1; RF=representative genome; TAX=186990; STAX=186990; NAME=Hipposideros armiger; AL=Scaffold; RT=Major
Sequence
MTGWAQRFLGGVRFQRPLRGVSNLPSQALLGTEASISVNIVLSGRLSSAVPALAACSGKL
EQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLG
PAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQ
SDEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRC
LPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVD
TQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAY
HARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDMSDTGEQGCFSEPQRCDGWWHCASG
RDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLC
IFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRT
QEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMR
RQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPATGAA
PDPQAPLTDTGSPGAAGDGSPSAPGHTPEVGPSMPPSSGLRDPEYRPVDKDRKACRDPLV
DSPAPVDMLQEACSAQDPHPMTPTASNTLGPHPPEPLGVCRSPQLPCSPTLEASDDEALL
VC
Download sequence
Identical sequences XP_019510084.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]