SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019514766.1.44202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019514766.1.44202
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-24
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-20
Family KRAB domain (Kruppel-associated box) 0.00038
Further Details:      
 
Domain Number 7 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 585-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 164-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000798
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 84-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000861
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 420-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000224
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 504-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000085
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019514766.1.44202
Sequence length 648
Comment PREDICTED: zinc finger protein 709-like [Hipposideros armiger]; AA=GCF_001890085.1; RF=representative genome; TAX=186990; STAX=186990; NAME=Hipposideros armiger; AL=Scaffold; RT=Major
Sequence
MDSVAFEDVAVTFTLEEWALLDPSQKKLYRDVMRETFRNLASIGKKWDDHHIEDQYKNQG
RKRRCNMAERDCEGKVSSQCGENFSLIPNLSQKNKTLPGLKPWQYSVCGKVFTYDSSYNR
DIRCHTGHKSSEYQKYGEKPYKCNVCGRAFNFIQFSEKHERNPNGDKSYKCKQCEKAFMC
LKSPQRHMITHTVDAPYKCKVCGKTFSSSTSLQICERTHTGEKPYECKFCGKAFRYYKSF
QRHERNHPGEKPYECKKCSKAFRYPSHLQIHERTHTEEKPYECKECGKAFRSYSSLQPHE
MTHTGEKPYECKECGKAFRYYSSLQIHERSHTGEKPYECKKCNKAFSAPSCLRKHERIHT
AEKPYECKECGKAFRFYSSLQTHERTHTGEKPYECKQCGKALRYYSSLQIHERIHTGEKP
YECKECGNAFRCNSFLKIHKKSHTGEKPYECEKCSKVFSTPSNLRIHERTHTAEKPYECK
ECGKAFRYYRSLQTHERTHTGEKPYECKQCGKAFICRTTIQRHMKMHTGNTPYQCKECGK
AFTCLSLYQRHERTHTGEKPYECKQCGKAYRDHSSLQRHERTHTGEKPYECKECGKAFVC
NKIFRIHMMRVHTAEKPYKCEECGKAFSHPYSFRRHERTHWIKTYECK
Download sequence
Identical sequences XP_019514766.1.44202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]