SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019542197.1.17567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019542197.1.17567
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.49e-69
Family A middle domain of Talin 1 0.0000162
Further Details:      
 
Domain Number 2 Region: 679-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.27e-51
Family I/LWEQ domain 0.0000406
Further Details:      
 
Domain Number 3 Region: 771-905
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.63e-43
Family I/LWEQ domain 0.00015
Further Details:      
 
Domain Number 4 Region: 1234-1370
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.3e-33
Family alpha-catenin/vinculin 0.053
Further Details:      
 
Domain Number 5 Region: 1856-1983
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-33
Family VBS domain 0.00042
Further Details:      
 
Domain Number 6 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-31
Family Second domain of FERM 0.0000072
Further Details:      
 
Domain Number 7 Region: 320-410
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-25
Family Third domain of FERM 0.0000457
Further Details:      
 
Domain Number 8 Region: 1480-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000209
Family I/LWEQ domain 0.011
Further Details:      
 
Domain Number 9 Region: 962-1067
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000275
Family I/LWEQ domain 0.004
Further Details:      
 
Domain Number 10 Region: 1595-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000926
Family VBS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019542197.1.17567
Sequence length 2110
Comment PREDICTED: talin-2-like isoform X7 [Aedes albopictus]; AA=GCF_001876365.2; RF=representative genome; TAX=7160; STAX=7160; NAME=Aedes albopictus; AL=Contig; RT=Major
Sequence
MSALSLRISLEGGRVTKTIQFDPNTTVFDACRIIKDKFAEAVQGQAQEFGLFLADEDTRQ
GVWLEPARNLGYYLLRNHDVLEYRRKHRNLRVRMLDGALKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDPDSQNENLPDNKSNMGTLTLRRKVAERERDAKMESLRKKLRTDDE
IHWVDVGKTLREQGIDESETVLLRRKFFYSDQNIDSRDPVQLNLLYVQARDAILDGTHPV
TQEKACEFAGIQVQIQFGDHNESKHKPGFLDLREFLPGSYARVKNIEKKVFAEHRKHQGL
SDLDAKYLYTKTARELPTYGVTFFLVKEKMTGKNKLVPRLLGVTKSSVLRLDETTKEILK
TWPLTTVRRWGASPNTFTLDFGDYADQYYSVQTTEAEQIVQLIAGYIDIILKKKQAKEHF
GIEGDEGSTMVEESVAPSKATFLQHEETTPSGKVETQSIAKPAIMRGYDGERPYGTGEMQ
SMQYGAIVGQVNLAHQPPMLQQTRISTVLSEPQRALVGYISAGQDAINKAEKDLESKAQL
PPLGTDPGSLQWREETLDTSKQTVTTHLATMNAATAQVVTASQPDEIDHDAVGAAVSQIT
QSIPEVTKEVRLIAALMDDDCTGDKLLEATRKLCSAFSDLLKSAEPESKEPRQNLLNAAS
RVGEASGQVLSSMGEESMESRELHDMLLGLAKAVANTTAALVLKAKSIAAVTEDEATRNR
VIAAASQCALATSQLVACARVVAPTIQSPACREQLEAAAREVAKAVAHLVEVCNEATDNQ
QLRGDLMNAAKDVSKTLAELLEHIKLSSREKARRVDDNPVEEVLVATDILVSASDPQEMI
RQAQQLGKATAQLIQSIKGEAERQEDSNLQRKLLEAAKQLADATARMVEAARLCAGNPHD
SGHQESLRIAAEELRVITTTTANTPEIKRRLINRLEQCSKQAAAAATQCITAAQNALMHS
NDVQTKEILLQDCQTVADQIPRLVAGVKNTLSRPDDPNAQLGLIDAAEMFLEPGAQVAQS
ARDLQPTVMDQAASQQLSRSAQNLSHAIIDLRSAAHRAREACGGNELDAALQAVRNLRNV
LDDTRRAGQEGSLRPLPGETADSCFKQLAAASNNVDSSLYQLMSAVQQSNRTYAGVAGRD
AALALGEYTKSVRGVVATTKNPAVVDCADQVILDSILVIEEAQKTLQNLGNQDHLVQAIK
RTKGSLGRTIDCFPGVKDINEAYENMADLRAILDTGEFPPSTRAYGQLQNELKSAADTLN
TAGGQVAHSYDSSIKLANTSQDFYHAYKELMTVTLEMAGQTVEDRAREEIVNSLRGVSNQ
SATLLGTAKFVAGDPDRPNAKNELSSAARMVTESINRLVDVCTQAAPGQKECDSAIRSIE
SLRPLLESAQEPLTDQGYFDCLDTVMEKSRTLGDGMTGIANNAKLSKHVEFGHSVDSVSD
SIRGLIESAAQAAYLVGISNPTSVGGRPGLVDQAQFARASQAIRQSCEVLRGPTSSQQQV
LSAATIIAKHTSALCNACRNASSTTTNPVAKRHFVQAAKEVANSTADLVREIKALDKDYS
PVSRARCAGATEPLLEAVSSLCQFANSPEFISIPARISTEGRKAQEPILHAGRGILDGAV
DMVKTAKVLAMTPTDPPVWQQLAIHSRNVSESIKKLASSIREKAPGQLQCDQVLEMLKSC
SRDLNSAALAVGVDGLPQRKENNLQGFTNQSLNAASELIDRLEPVKSSAKKNAESLGHAV
NQIAKHIIPLTNGVIGACSHVVHSGQQTVLIDQVKSVVECCSQLVQVAKSAGGNPRASHL
HPELDEAVESTREAIQELNATVERLSTENGVVTGLMEQISRSMARITDKRQSFLGTSIND
TFVDYQTRMVQSAKEIARYANEINAKAAIDPSKLAQLSVEMTHHYSQLAQDSIGASALTT
SPDVAIRIRQTVTDLGRSVNVLIQSTAGIRKDDSSGLVEISRGARDVSEKVSQVLAALQA
GSRGTQACINASSTVSAIISDLDTTIMFATAGTLHSEEEGKFSDHREHILKTAKALVEDT
KILVAGAAGTQDQLAAAAQNAVTTILQLAEAVKHGAASLGSNQPDSQVMVMNAVKDVAAA
LGGTTGCTGV
Download sequence
Identical sequences XP_019542197.1.17567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]