SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019544914.1.17567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019544914.1.17567
Domain Number 1 Region: 134-534
Classification Level Classification E-value
Superfamily L domain-like 3.13e-48
Family Internalin LRR domain 0.073
Further Details:      
 
Domain Number 2 Region: 781-933
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-43
Family Toll/Interleukin receptor TIR domain 0.00023
Further Details:      
 
Domain Number 3 Region: 587-721
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000315
Family Ngr ectodomain-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019544914.1.17567
Sequence length 952
Comment PREDICTED: protein toll-like [Aedes albopictus]; AA=GCF_001876365.2; RF=representative genome; TAX=7160; STAX=7160; NAME=Aedes albopictus; AL=Contig; RT=Major
Sequence
MNVQLQLSENTSLLLLWNVLFFVTIASAMITISEESSCEDVVATGECECSRGLVSLYVRC
NISGSIYQGRFIGNQSASIECSGKPVTNRTLIIGKRSQVQLRNCLHHIDPTSLRRTLDTF
GTIDERRVEIVFDNDTAFNLSENYFQGFHELKTLRLNFKMQIQSPNVFNELTMLEQLTLR
GNLNELPSDLLIEQYNLTQLNLKDNQIEDIPANFFRHQNMLVHLDISANLLTSITETTFS
NLSSLVYLDLSNNLIQSMHAKAFHNTTKLKFLMLKVNKLASIPPTLLRGLTRLSNLDISA
NQLRLLPPDLLRNHTQLFRSDLSKNGIQTLPEALFETNGALQYVNISHNNLVTLPSKLFH
TLQRLISLDLSNNQLSSLDPDIFDQSPYVNFLYLQNNHLWFAGSLYRNEHDLEESSYSPF
WPIRMQLRELNLRNNNIDRMDIAWIESPELKRLDLSYNKLVKFDNEDFKFMSEEMVVNLE
FNQIAMLSLVAADATRGSGGFILFKLNHNPLNCNCRIASFVRFLQMTGHVYRRWRFTVDH
LRCIDPEINREINVVKVNIGNLLCEMNDHCPDRCGCFVRSNNESVLVNCEGQNLTDLPNL
TDVSRNFNHVELFVTNNNIKSFDVVDPQGYEKVKEFYASYNQIQNLTGSLLPNVEILDLS
NNSLSSFSQLTLLFNNSRQLESAKLSSNPWQCDCQLINHLRIIQNSSDRIVDSKYMRCSD
GRDFNLLTVSDLCPMGGIATIIIFMCSVVILILLVSFIAYAYQIEIKIWLFTNNLCLRLV
TEEEIDKDKLYDAFVSYCHQDEEFVSATLVPRLETAPMNLKVCWHMRDWNPGEVITTQIV
QSIENSRRTIVVLSRDFLESSWGQLEFRTAHVNSMAEKRIRVIIVIYGDLGDEERIDSEM
KAYLKTNTYIKWGDPWFWHKLRYSMPHPARVKGVRWNRASNRVDVMGTSDVS
Download sequence
Identical sequences XP_019544914.1.17567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]